Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For GBGL7992-12     Back to Search: Records
  IDENTIFIERS:
  Sample ID: EU364326 Museum ID: 142-ADW
  Field ID: EU364326 Collection Code:
  Deposited In: Mined from GenBank, NCBI
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily: Eudaminae
  Class: Insecta Genus: Astraptes
  Order: Lepidoptera Species: Astraptes fulgerator
  Family: Hesperiidae Subspecies:
  BIN (Cluster ID):
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Reproduction:
  Tissue Descriptor: Sex:
  Brief Note: Life Stage:
  Detailed Notes: Astraptes fulgerator
 
  COLLECTION DATA:
  Country: Costa Rica Date Collected:
  Province/State: Collectors:
  Region/County: Guanacaste Prov., Acg    
  Sector:    
  Exact Site:    
  Latitude: Elevation:
  Longitude: Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: COI-3P   [Funding Source: N/A]
  Sequence ID: GBGL7992-12.COI-3P GenBank Accession: EU364326
  Last Updated: 2017-07-17 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 3' Region
  Nucleotides: 708 bp
 
ATTGGATTACTAGGATTTATTGTTTGAGCTCATCATATATTTACTGTAGGAATAGATATTGATACACGAGCTTAC
TTTACTTCAGCTACTATAATTATTGCTGTCCCCACTGGAATTAAAATTTTTAGTTGATTAGCAACACTTCATGGT
ACTCAAATTAATTATAGACCATCTATATTATGAAGATTAGGATTTGTATTTCTATTTACCGTAGGAGGATTAACA
GGAGTAATTTTAGCTAATTCATCAATTGATATTACTTTACATGATACTTATTATGTTGTAGCACATTTTCATTAT
GTTCTCTCTATAGGAGCTGTATTTGCTATTTTTGGAGGATTCATTCATTGATATCCTTTATTTACTGGACTTACT
CTTAATCCTTATTTATTAAAAATTCAATTTATTTCTATATTTTTTGGTGTTAATTTAACCTTTTTCCCCCAACAT
TTTTTAGGCTTAGCAGGAATACCTCGACGATATTCTGATTATCCTGATAGCTACATTTCATGAAATGTAATTTCT
TCTTTCGGATCATATATTTCATTACTATCAATAATAATAATAATAATTATTATCTGAGAATCAATAATTAATCAA
CGATTAATTTTATTTCCTTTAAATATATCATCTTCTATTGAATGACTCCAAAATTTACCTCCTGCTGAACATTCT
TATAATGAATTACCTATTTTAAGAAACTTCTAA
  Amino Acids:  
 
IGLLGFIVWAHHMFTVGMDIDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQINYSPSMLWSLGFVFLFTVGGLT
GVILANSSIDITLHDTYYVVAHFHYVLSMGAVFAIFGGFIHWYPLFTGLTLNPYLLKIQFISMFFGVNLTFFPQH
FLGLAGMPRRYSDYPDSYISWNVISSFGSYISLLSMMMMMIIIWESMINQRLILFPLNMSSSIEWLQNLPPAEHS
YNELPILSNF*
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
Generated using the BOLD API

													
  Specimen Images: N/A
Collection Site: N/A
  Attribution:
Specimen Depository: Mined from GenBank, NCBI
Sequencing Center:
Photography:
Collectors:
Specimen Identification:
Project Manager: Sujeevan Test Ratnasingham
Sequencing Support: